PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KDD75554.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
Family Nin-like
Protein Properties Length: 269aa    MW: 28580 Da    PI: 8.3776
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KDD75554.1genomeUBCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK64.51.7e-204694452
      RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                +i+ +dl  +F+lp ++A+ +Lgv+l+vLKr+CR++G+ RWP+Rki+sl
  KDD75554.1 46 SITWQDLYDCFHLPATQASVKLGVSLSVLKRACRRLGVGRWPFRKISSL 94
                7999******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.92625116IPR003035RWP-RK domain
PfamPF020422.4E-174694IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MAAMEPLSGE ALQSRPELAS GGYILGGNLK RRTCSRLSKQ GVLPSSITWQ DLYDCFHLPA  60
TQASVKLGVS LSVLKRACRR LGVGRWPFRK ISSLKRKLGA DGAAGGLNDC VLDDREITDK  120
ALSKMAWASN SGCSDSHQHR GSVKDEDGDA WTSEDSSDER CGDGLRALGQ SDNGSLVDAD  180
RPARVWADER DGLSYNSMAS STTALRDSWG RIHFGRSLDM SLAEQSSLLL SAAGSSLGKP  240
SPSLTSFSAA FPPLGRGSSA AFRSLVPSP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAPTransfer from AT1G74480Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A059LNE40.0A0A059LNE4_9CHLO; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74480.12e-11RWP-RK domain-containing protein